Lineage for d1opd__ (1opd -)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 82634Fold d.94: Histidine-containing phosphocarrier proteins (HPr) [55593] (1 superfamily)
  4. 82635Superfamily d.94.1: Histidine-containing phosphocarrier proteins (HPr) [55594] (1 family) (S)
  5. 82636Family d.94.1.1: Histidine-containing phosphocarrier proteins (HPr) [55595] (1 protein)
  6. 82637Protein Histidine-containing phosphocarrier proteins (HPr) [55596] (6 species)
  7. 82649Species Escherichia coli [TaxId:562] [55599] (11 PDB entries)
  8. 82650Domain d1opd__: 1opd - [40560]

Details for d1opd__

PDB Entry: 1opd (more details), 1.5 Å

PDB Description: histidine-containing protein (hpr), mutant with ser 46 replaced by asp (s46d)

SCOP Domain Sequences for d1opd__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1opd__ d.94.1.1 (-) Histidine-containing phosphocarrier proteins (HPr) {Escherichia coli}
mfeqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakdlfklqtlgltqgtv
vtisaegedeqkavehlvklmaele

SCOP Domain Coordinates for d1opd__:

Click to download the PDB-style file with coordinates for d1opd__.
(The format of our PDB-style files is described here.)

Timeline for d1opd__: