Lineage for d1cm2a_ (1cm2 A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34701Fold d.94: Histidine-containing phosphocarrier proteins (HPr) [55593] (1 superfamily)
  4. 34702Superfamily d.94.1: Histidine-containing phosphocarrier proteins (HPr) [55594] (1 family) (S)
  5. 34703Family d.94.1.1: Histidine-containing phosphocarrier proteins (HPr) [55595] (1 protein)
  6. 34704Protein Histidine-containing phosphocarrier proteins (HPr) [55596] (6 species)
  7. 34716Species Escherichia coli [TaxId:562] [55599] (11 PDB entries)
  8. 34719Domain d1cm2a_: 1cm2 A: [40558]

Details for d1cm2a_

PDB Entry: 1cm2 (more details), 1.8 Å

PDB Description: structure of his15asp hpr after hydrolysis of ringed species.

SCOP Domain Sequences for d1cm2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cm2a_ d.94.1.1 (A:) Histidine-containing phosphocarrier proteins (HPr) {Escherichia coli}
mfqqevtitapngldtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
vtisaegedeqkavehlvklmaele

SCOP Domain Coordinates for d1cm2a_:

Click to download the PDB-style file with coordinates for d1cm2a_.
(The format of our PDB-style files is described here.)

Timeline for d1cm2a_: