Lineage for d7m32b5 (7m32 B:845-1018)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2555939Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2556102Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 2556117Protein Dihydropyrimidine dehydrogenase, C-terminal domain [54891] (1 species)
    includes linker from domain 4
  7. 2556118Species Pig (Sus scrofa) [TaxId:9823] [54892] (9 PDB entries)
  8. 2556132Domain d7m32b5: 7m32 B:845-1018 [405564]
    Other proteins in same PDB: d7m32a1, d7m32a2, d7m32a3, d7m32a4, d7m32b1, d7m32b2, d7m32b3, d7m32b4, d7m32c1, d7m32c2, d7m32c3, d7m32c4, d7m32d1, d7m32d2, d7m32d3, d7m32d4
    automated match to d1h7xb5
    complexed with ala, fad, fnr, leu, pro, sf4, ura; mutant

Details for d7m32b5

PDB Entry: 7m32 (more details), 1.82 Å

PDB Description: dihydropyrimidine dehydrogenase (dpd) c671a mutant soaked with uracil and nadph anaerobically
PDB Compounds: (B:) Dihydropyrimidine dehydrogenase [NADP(+)]

SCOPe Domain Sequences for d7m32b5:

Sequence; same for both SEQRES and ATOM records: (download)

>d7m32b5 d.58.1.5 (B:845-1018) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
elqgwdgqspgteshqkgkpvpriaelmgkklpnfgpyleqrkkiiaeekmrlkeqnaaf
pplerkpfipkkpipaikdvigkalqylgtfgelsnieqvvavideemcincgkcymtcn
dsgyqaiqfdpethlptvtdtctgctlclsvcpiidcirmvsrttpyepkrglp

SCOPe Domain Coordinates for d7m32b5:

Click to download the PDB-style file with coordinates for d7m32b5.
(The format of our PDB-style files is described here.)

Timeline for d7m32b5: