SCOPe 2.08: Domain d7m32b2: 7m32 B:184-287,B:441-532

Lineage for d7m32b2 (7m32 B:184-287,B:441-532)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like

4. Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families)
   this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains

5. Family c.4.1.1: N-terminal domain of adrenodoxin reductase-like [51972] (5 proteins)

6. Protein Dihydropyrimidine dehydrogenase, domain 2 [51977] (1 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [51978] (9 PDB entries)

8. Domain d7m32b2: 7m32 B:184-287,B:441-532 [405561]
   Other proteins in same PDB: d7m32a1, d7m32a3, d7m32a4, d7m32a5, d7m32b1, d7m32b3, d7m32b4, d7m32b5, d7m32c1, d7m32c3, d7m32c4, d7m32c5, d7m32d1, d7m32d3, d7m32d4, d7m32d5
   automated match to d1h7xb4
   complexed with ala, fad, fnr, leu, pro, sf4, ura; mutant

Details for d7m32b2

PDB Entry: 7m32, 1.82 Å

PDB Description: dihydropyrimidine dehydrogenase (dpd) c671a mutant soaked with uracil and nadph anaerobically

PDB Compounds: (B:) Dihydropyrimidine dehydrogenase [NADP(+)]

SCOPe Domain Sequences for d7m32b2:

Sequence; same for both SEQRES and ATOM records:

>d7m32b2 c.4.1.1 (B:184-287,B:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]}
eaysakiallgagpasiscasflarlgysditifekqeyvgglstseipqfrlpydvvnf
eielmkdlgvkiicgkslseneitlntlkeegykaafigiglpeXvlrdpkvkealspik
fnrwdlpevdpetmqtsepwvfaggdivgmanttvesvndgkqaswyihkyiqaqygasv
sakpelplfytpvdlvd

Timeline for d7m32b2:

• d7m32b2 first appeared in SCOPe 2.07