![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) ![]() contains two Fe4-S4 clusters |
![]() | Family a.1.2.2: Dihydropyrimidine dehydrogenase, N-terminal domain [46553] (1 protein) |
![]() | Protein Dihydropyrimidine dehydrogenase, N-terminal domain [46554] (1 species) includes the N-terminal tail and the linker to domain 2 |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [46555] (9 PDB entries) |
![]() | Domain d7m32b1: 7m32 B:3-183 [405560] Other proteins in same PDB: d7m32a2, d7m32a3, d7m32a4, d7m32a5, d7m32b2, d7m32b3, d7m32b4, d7m32b5, d7m32c2, d7m32c3, d7m32c4, d7m32c5, d7m32d2, d7m32d3, d7m32d4, d7m32d5 automated match to d1h7xb1 complexed with ala, fad, fnr, leu, pro, sf4, ura; mutant |
PDB Entry: 7m32 (more details), 1.82 Å
SCOPe Domain Sequences for d7m32b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7m32b1 a.1.2.2 (B:3-183) Dihydropyrimidine dehydrogenase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} pvlskdvadiesilalnprtqshaalhstlakkldkkhwkrnpdkncfhceklennfddi khttlgergalreamrclkcadapcqkscpthldiksfitsisnknyygaakmifsdnpl gltcgmvcptsdlcvggcnlyateegsinigglqqfasevfkamnipqirnpclpsqekm p
Timeline for d7m32b1:
![]() Domains from same chain: (mouse over for more information) d7m32b2, d7m32b3, d7m32b4, d7m32b5 |