![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) ![]() |
![]() | Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins) members of this "family" may be more closely related to other ferredoxins than to each other |
![]() | Protein Dihydropyrimidine dehydrogenase, C-terminal domain [54891] (1 species) includes linker from domain 4 |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [54892] (9 PDB entries) |
![]() | Domain d7m32c5: 7m32 C:845-1017 [405559] Other proteins in same PDB: d7m32a1, d7m32a2, d7m32a3, d7m32a4, d7m32b1, d7m32b2, d7m32b3, d7m32b4, d7m32c1, d7m32c2, d7m32c3, d7m32c4, d7m32d1, d7m32d2, d7m32d3, d7m32d4 automated match to d1h7xa5 complexed with ala, fad, fnr, leu, pro, sf4, ura; mutant |
PDB Entry: 7m32 (more details), 1.82 Å
SCOPe Domain Sequences for d7m32c5:
Sequence; same for both SEQRES and ATOM records: (download)
>d7m32c5 d.58.1.5 (C:845-1017) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} elqgwdgqspgteshqkgkpvpriaelmgkklpnfgpyleqrkkiiaeekmrlkeqnaaf pplerkpfipkkpipaikdvigkalqylgtfgelsnieqvvavideemcincgkcymtcn dsgyqaiqfdpethlptvtdtctgctlclsvcpiidcirmvsrttpyepkrgl
Timeline for d7m32c5:
![]() Domains from same chain: (mouse over for more information) d7m32c1, d7m32c2, d7m32c3, d7m32c4 |