![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) ![]() |
![]() | Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins) |
![]() | Protein Dihydropyrimidine dehydrogenase, domain 4 [51410] (1 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [51411] (9 PDB entries) |
![]() | Domain d7m32c4: 7m32 C:533-844 [405558] Other proteins in same PDB: d7m32a1, d7m32a2, d7m32a3, d7m32a5, d7m32b1, d7m32b2, d7m32b3, d7m32b5, d7m32c1, d7m32c2, d7m32c3, d7m32c5, d7m32d1, d7m32d2, d7m32d3, d7m32d5 automated match to d1h7xa2 complexed with ala, fad, fnr, leu, pro, sf4, ura; mutant has additional subdomain(s) that are not in the common domain has additional insertions and/or extensions that are not grouped together |
PDB Entry: 7m32 (more details), 1.82 Å
SCOPe Domain Sequences for d7m32c4:
Sequence, based on SEQRES records: (download)
>d7m32c4 c.1.4.1 (C:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} isvemaglkfinpfglasaapttsssmirrafeagwgfaltktfsldkdivtnvsprivr gttsgpmygpgqssflnielisektaaywcqsvtelkadfpdniviasimcsynkndwme lsrkaeasgadalelnlsaphgmgergmglacgqdpelvrnicrwvrqavqipffakltp nvtdivsiaraakeggadgvtatntvsglmglkadgtpwpavgagkrttyggvsgtairp ialravttiaralpgfpilatggidsaesglqflhsgasvlqvcsavqnqdftviqdyct glkallylksie
>d7m32c4 c.1.4.1 (C:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} isvemaglkfinpfglasaapttsssmirrafeagwgfaltktfsldkdivtnvsprivr gttsgpmygpgqssflnielisektaaywcqsvtelkadfpdniviasimcsynkndwme lsrkaeasgadalelnlsaphlacgqdpelvrnicrwvrqavqipffakltpnvtdivsi araakeggadgvtatntvsglmglkadgtpwpavgagkrttyggvsgtairpialravtt iaralpgfpilatggidsaesglqflhsgasvlqvcsavqnqdftviqdyctglkallyl ksie
Timeline for d7m32c4:
![]() Domains from same chain: (mouse over for more information) d7m32c1, d7m32c2, d7m32c3, d7m32c5 |