Lineage for d3ezab_ (3eza B:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 82634Fold d.94: Histidine-containing phosphocarrier proteins (HPr) [55593] (1 superfamily)
  4. 82635Superfamily d.94.1: Histidine-containing phosphocarrier proteins (HPr) [55594] (1 family) (S)
  5. 82636Family d.94.1.1: Histidine-containing phosphocarrier proteins (HPr) [55595] (1 protein)
  6. 82637Protein Histidine-containing phosphocarrier proteins (HPr) [55596] (6 species)
  7. 82649Species Escherichia coli [TaxId:562] [55599] (11 PDB entries)
  8. 82656Domain d3ezab_: 3eza B: [40555]
    Other proteins in same PDB: d3ezaa1, d3ezaa2

Details for d3ezab_

PDB Entry: 3eza (more details)

PDB Description: complex of the amino terminal domain of enzyme i and the histidine- containing phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure

SCOP Domain Sequences for d3ezab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ezab_ d.94.1.1 (B:) Histidine-containing phosphocarrier proteins (HPr) {Escherichia coli}
mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
vtisaegedeqkavehlvklmaele

SCOP Domain Coordinates for d3ezab_:

Click to download the PDB-style file with coordinates for d3ezab_.
(The format of our PDB-style files is described here.)

Timeline for d3ezab_: