![]() | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
![]() | Fold d.94: HPr-like [55593] (2 superfamilies) beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423 |
![]() | Superfamily d.94.1: HPr-like [55594] (1 family) ![]() |
![]() | Family d.94.1.1: HPr-like [55595] (2 proteins) |
![]() | Protein Histidine-containing phosphocarrier protein (HPr) [55596] (6 species) |
![]() | Species Escherichia coli [TaxId:562] [55599] (12 PDB entries) |
![]() | Domain d2jelp_: 2jel P: [40554] Other proteins in same PDB: d2jelh1, d2jelh2, d2jell1, d2jell2 complexed with so4 |
PDB Entry: 2jel (more details), 2.5 Å
SCOP Domain Sequences for d2jelp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jelp_ d.94.1.1 (P:) Histidine-containing phosphocarrier protein (HPr) {Escherichia coli} mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv vtisaegedeqkavehlvklmaele
Timeline for d2jelp_:
![]() Domains from other chains: (mouse over for more information) d2jelh1, d2jelh2, d2jell1, d2jell2 |