Lineage for d2jelp_ (2jel P:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 416178Fold d.94: HPr-like [55593] (2 superfamilies)
    beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423
  4. 416179Superfamily d.94.1: HPr-like [55594] (1 family) (S)
  5. 416180Family d.94.1.1: HPr-like [55595] (2 proteins)
  6. 416190Protein Histidine-containing phosphocarrier protein (HPr) [55596] (6 species)
  7. 416208Species Escherichia coli [TaxId:562] [55599] (12 PDB entries)
  8. 416213Domain d2jelp_: 2jel P: [40554]
    Other proteins in same PDB: d2jelh1, d2jelh2, d2jell1, d2jell2
    complexed with so4

Details for d2jelp_

PDB Entry: 2jel (more details), 2.5 Å

PDB Description: jel42 fab/hpr complex

SCOP Domain Sequences for d2jelp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jelp_ d.94.1.1 (P:) Histidine-containing phosphocarrier protein (HPr) {Escherichia coli}
mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
vtisaegedeqkavehlvklmaele

SCOP Domain Coordinates for d2jelp_:

Click to download the PDB-style file with coordinates for d2jelp_.
(The format of our PDB-style files is described here.)

Timeline for d2jelp_: