SCOPe 2.07: Domain d7lnla_: 7lnl A:

Lineage for d7lnla_ (7lnl A:)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (70 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [225260] (109 PDB entries)

8. Domain d7lnla_: 7lnl A: [405524]
   automated match to d3c5aa_
   complexed with 8yf; mutant

Details for d7lnla_

PDB Entry: 7lnl, 1.82 Å

PDB Description: crystal structure of kpc-2 s70g/t215p mutant with hydrolyzed imipenem

PDB Compounds: (A:) Carbapenem-hydrolyzing beta-lactamase KPC

SCOPe Domain Sequences for d7lnla_:

Sequence; same for both SEQRES and ATOM records:

>d7lnla_ e.3.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
tnlvaepfakleqdfggsigvyamdtgsgatvsyraeerfplcgsfkgflaaavlarsqq
qaglldtpirygknalvpwspisekylttgmtvaelsaaavqysdnaaanlllkelggpa
gltafmrsigdttfrldrwelelnsaipgdardtsspravteslqkltlgsalaapqrqq
fvdwlkgnptgnhriraavpadwavgdktgtcgvygtandyavvwptgrapivlavytra
pnkddkhseaviaaaarlaleglg

Timeline for d7lnla_:

• d7lnla_ is new in SCOPe 2.07-stable
  
• d7lnla_ appears in the current release, SCOPe 2.08