SCOP 1.69: Domain d1ptf__: 1ptf -

Lineage for d1ptf__ (1ptf -)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.94: HPr-like [55593] (2 superfamilies)
   beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423

4. Superfamily d.94.1: HPr-like [55594] (1 family)

5. Family d.94.1.1: HPr-like [55595] (2 proteins)

6. Protein Histidine-containing phosphocarrier protein (HPr) [55596] (6 species)

7. Species Enterococcus faecalis [TaxId:1351] [55598] (3 PDB entries)

8. Domain d1ptf__: 1ptf - [40549]

Details for d1ptf__

PDB Entry: 1ptf, 1.6 Å

PDB Description: the 1.6 angstroms structure of histidine-containing phosphotransfer protein hpr from streptococcus faecalis

SCOP Domain Sequences for d1ptf__:

Sequence; same for both SEQRES and ATOM records:

>d1ptf__ d.94.1.1 (-) Histidine-containing phosphocarrier protein (HPr) {Enterococcus faecalis}
mekkefhivaetgiharpatllvqtaskfnsdinleykgksvnlksimgvmslgvgqgsd
vtitvdgadeaegmaaivetlqkegla

Timeline for d1ptf__:

• d1ptf__ first appeared (with stable ids) in SCOP 1.55
  
• d1ptf__ appears in SCOP 1.67
  
• d1ptf__ appears in SCOP 1.71
  
• d1ptf__ appears in the current release, SCOPe 2.08, called d1ptfa_