Class g: Small proteins [56992] (100 folds) |
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) |
Family g.17.1.0: automated matches [191392] (1 protein) not a true family |
Protein automated matches [190506] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187459] (39 PDB entries) |
Domain d7l0ja_: 7l0j A: [405465] automated match to d5jhwa_ complexed with nag, so4 |
PDB Entry: 7l0j (more details), 2.6 Å
SCOPe Domain Sequences for d7l0ja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7l0ja_ g.17.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} dgpcalrelsvdlraersvlipetyqanncqgvcgwpqsdrnprygnhvvlllkmqarga alarppccvptayagkllislseerisahhvpnmvatecgcr
Timeline for d7l0ja_: