Class b: All beta proteins [48724] (178 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
Protein automated matches [190576] (50 species) not a true protein |
Species Plasmodium falciparum [TaxId:36329] [234564] (7 PDB entries) |
Domain d6l3ya1: 6l3y A:80-227 [405457] Other proteins in same PDB: d6l3ya2, d6l3yb2 automated match to d3bjua1 protein/RNA complex; complexed with e5c, lys, po4 |
PDB Entry: 6l3y (more details), 3.1 Å
SCOPe Domain Sequences for d6l3ya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6l3ya1 b.40.4.0 (A:80-227) automated matches {Plasmodium falciparum [TaxId: 36329]} prlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnitgri mrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfpgks kkgelsifpketillsaclhmlpmkygl
Timeline for d6l3ya1: