Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices |
Superfamily d.93.1: SH2 domain [55550] (1 family) |
Family d.93.1.1: SH2 domain [55551] (22 proteins) |
Protein The Xlp protein Sap [55591] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [55592] (5 PDB entries) |
Domain d1d4wb_: 1d4w B: [40543] complex with slam phosphopeptide mutant |
PDB Entry: 1d4w (more details), 1.8 Å
SCOP Domain Sequences for d1d4wb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d4wb_ d.93.1.1 (B:) The Xlp protein Sap {Human (Homo sapiens)} avavyhgkisretgeklllatgldgsyllrdsesvpgvyclcvlyhgyiytyrvsqtetg swsaetapgvhkryfrkiknlisafqkpdqgiviplqypvek
Timeline for d1d4wb_: