Lineage for d1d4wb_ (1d4w B:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.93: SH2-like [55549] (1 superfamily) Superfamily d.93.1: SH2 domain [55550] (1 family) 
Family d.93.1.1: SH2 domain [55551] (19 proteins) 
Protein The Xlp protein Sap [55591] (1 species) Species Human (Homo sapiens) [TaxId:9606] [55592] (3 PDB entries) 
Domain d1d4wb_: 1d4w B: [40543]
Details for d1d4wb_
PDB Entry: 1d4w (more details), 1.8 Å
PDB Description: crystal structure of the xlp protein sap in complex with slam phosphopeptide
SCOP Domain Sequences for d1d4wb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d4wb_ d.93.1.1 (B:) The Xlp protein Sap {Human (Homo sapiens)}
avavyhgkisretgeklllatgldgsyllrdsesvpgvyclcvlyhgyiytyrvsqtetg
swsaetapgvhkryfrkiknlisafqkpdqgiviplqypvek
SCOP Domain Coordinates for d1d4wb_:
Click to download the PDB-style file with coordinates for d1d4wb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1d4wb_:
- d1d4wb_ appears in SCOP 1.57
- d1d4wb_ appears in the current release, SCOPe 2.08
View in 3D
