Lineage for d1d4wb_ (1d4w B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2530460Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2530461Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2530462Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2530848Protein The Xlp protein Sap [55591] (1 species)
  7. 2530849Species Human (Homo sapiens) [TaxId:9606] [55592] (6 PDB entries)
  8. 2530856Domain d1d4wb_: 1d4w B: [40543]
    complex with slam phosphopeptide

Details for d1d4wb_

PDB Entry: 1d4w (more details), 1.8 Å

PDB Description: crystal structure of the xlp protein sap in complex with slam phosphopeptide
PDB Compounds: (B:) t cell signal transduction molecule sap

SCOPe Domain Sequences for d1d4wb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d4wb_ d.93.1.1 (B:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]}
avavyhgkisretgeklllatgldgsyllrdsesvpgvyclcvlyhgyiytyrvsqtetg
swsaetapgvhkryfrkiknlisafqkpdqgiviplqypvek

SCOPe Domain Coordinates for d1d4wb_:

Click to download the PDB-style file with coordinates for d1d4wb_.
(The format of our PDB-style files is described here.)

Timeline for d1d4wb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1d4wa_