SCOPe 2.08: Domain d7kh8a1: 7kh8 A:4-157

Lineage for d7kh8a1 (7kh8 A:4-157)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
   3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families)
   share the common active site structure with the family II

5. Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (3 proteins)
   automatically mapped to Pfam PF01451

6. Protein Tyrosine phosphatase [52790] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52792] (13 PDB entries)

8. Domain d7kh8a1: 7kh8 A:4-157 [405415]
   Other proteins in same PDB: d7kh8a2, d7kh8b2
   automated match to d5pnta_
   complexed with no3, we7

Details for d7kh8a1

PDB Entry: 7kh8, 1.3 Å

PDB Description: human lmptp in complex with inhibitor

PDB Compounds: (A:) Low molecular weight phosphotyrosine protein phosphatase

SCOPe Domain Sequences for d7kh8a1:

Sequence; same for both SEQRES and ATOM records:

>d7kh8a1 c.44.1.1 (A:4-157) Tyrosine phosphatase {Human (Homo sapiens) [TaxId: 9606]}
atksvlfvclgnicrspiaeavfrklvtdqnisenwrvdsaatsgyeignppdyrgqscm
krhgipmshvarqitkedfatfdyilcmdesnlrdlnrksnqvktckakiellgsydpqk
qliiedpyygndsdfetvyqqcvrccraflekah

Timeline for d7kh8a1:

• d7kh8a1 first appeared in SCOPe 2.07