Lineage for d7kh8a1 (7kh8 A:4-157)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2874827Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 2874828Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families) (S)
    share the common active site structure with the family II
  5. 2874829Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (3 proteins)
    automatically mapped to Pfam PF01451
  6. 2874853Protein Tyrosine phosphatase [52790] (5 species)
  7. 2874872Species Human (Homo sapiens) [TaxId:9606] [52792] (13 PDB entries)
  8. 2874873Domain d7kh8a1: 7kh8 A:4-157 [405415]
    Other proteins in same PDB: d7kh8a2, d7kh8b2
    automated match to d5pnta_
    complexed with no3, we7

Details for d7kh8a1

PDB Entry: 7kh8 (more details), 1.3 Å

PDB Description: human lmptp in complex with inhibitor
PDB Compounds: (A:) Low molecular weight phosphotyrosine protein phosphatase

SCOPe Domain Sequences for d7kh8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7kh8a1 c.44.1.1 (A:4-157) Tyrosine phosphatase {Human (Homo sapiens) [TaxId: 9606]}
atksvlfvclgnicrspiaeavfrklvtdqnisenwrvdsaatsgyeignppdyrgqscm
krhgipmshvarqitkedfatfdyilcmdesnlrdlnrksnqvktckakiellgsydpqk
qliiedpyygndsdfetvyqqcvrccraflekah

SCOPe Domain Coordinates for d7kh8a1:

Click to download the PDB-style file with coordinates for d7kh8a1.
(The format of our PDB-style files is described here.)

Timeline for d7kh8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d7kh8a2