Lineage for d1d1zd_ (1d1z D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965229Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2965623Protein The Xlp protein Sap [55591] (1 species)
  7. 2965624Species Human (Homo sapiens) [TaxId:9606] [55592] (6 PDB entries)
  8. 2965629Domain d1d1zd_: 1d1z D: [40541]
    complexed with so4

Details for d1d1zd_

PDB Entry: 1d1z (more details), 1.4 Å

PDB Description: crystal structure of the xlp protein sap
PDB Compounds: (D:) sap sh2 domain

SCOPe Domain Sequences for d1d1zd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d1zd_ d.93.1.1 (D:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]}
vavyhgkisretgeklllatgldgsyllrdsesvpgvyclcvlyhgyiytyrvsqtetgs
wsaetapgvhkryfrkiknlisafqkpdqgiviplqypvek

SCOPe Domain Coordinates for d1d1zd_:

Click to download the PDB-style file with coordinates for d1d1zd_.
(The format of our PDB-style files is described here.)

Timeline for d1d1zd_: