Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) |
Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
Protein The Xlp protein Sap [55591] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [55592] (6 PDB entries) |
Domain d1d1zd_: 1d1z D: [40541] complexed with so4 |
PDB Entry: 1d1z (more details), 1.4 Å
SCOPe Domain Sequences for d1d1zd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d1zd_ d.93.1.1 (D:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]} vavyhgkisretgeklllatgldgsyllrdsesvpgvyclcvlyhgyiytyrvsqtetgs wsaetapgvhkryfrkiknlisafqkpdqgiviplqypvek
Timeline for d1d1zd_: