Lineage for d7dz7e_ (7dz7 E:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2393361Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) (S)
  5. 2393472Family b.34.4.0: automated matches [191659] (1 protein)
    not a true family
  6. 2393473Protein automated matches [191237] (6 species)
    not a true protein
  7. 2393476Species Chlamydomonas reinhardtii [TaxId:3055] [370429] (4 PDB entries)
  8. 2393477Domain d7dz7e_: 7dz7 E: [405408]
    Other proteins in same PDB: d7dz71_, d7dz73_, d7dz74_, d7dz77_, d7dz78_, d7dz79_, d7dz7a_, d7dz7b_, d7dz7c_, d7dz7d_, d7dz7f_, d7dz7j_, d7dz7u_, d7dz7v_, d7dz7w_, d7dz7x_, d7dz7y_, d7dz7z_
    automated match to d4y28e_
    complexed with bcr, chl, cla, dgd, lhg, lmg, lmu, lut, nex, pqn, sf4, tpo, xat; mutant

Details for d7dz7e_

PDB Entry: 7dz7 (more details), 2.84 Å

PDB Description: state transition supercomplex psi-lhci-lhcii from double phosphatase mutant pph1;pbcp of green alga chlamydomonas reinhardtii
PDB Compounds: (E:) Photosystem I reaction center subunit IV, chloroplastic

SCOPe Domain Sequences for d7dz7e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7dz7e_ b.34.4.0 (E:) automated matches {Chlamydomonas reinhardtii [TaxId: 3055]}
evgpkrgslvkilrpesywfnqvgkvvsvdqsgvrypvvvrfenqnyagvttnnyaldev
vaa

SCOPe Domain Coordinates for d7dz7e_:

Click to download the PDB-style file with coordinates for d7dz7e_.
(The format of our PDB-style files is described here.)

Timeline for d7dz7e_: