SCOP 1.63: Domain d1d1zc_: 1d1z C:

Lineage for d1d1zc_ (1d1z C:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (1 family)

5. Family d.93.1.1: SH2 domain [55551] (22 proteins)

6. Protein The Xlp protein Sap [55591] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55592] (5 PDB entries)

8. Domain d1d1zc_: 1d1z C: [40540]

Details for d1d1zc_

PDB Entry: 1d1z, 1.4 Å

PDB Description: crystal structure of the xlp protein sap

SCOP Domain Sequences for d1d1zc_:

Sequence; same for both SEQRES and ATOM records:

>d1d1zc_ d.93.1.1 (C:) The Xlp protein Sap {Human (Homo sapiens)}
vavyhgkisretgeklllatgldgsyllrdsesvpgvyclcvlyhgyiytyrvsqtetgs
wsaetapgvhkryfrkiknlisafqkpdqgiviplqypvek

Timeline for d1d1zc_:

• d1d1zc_ first appeared (with stable ids) in SCOP 1.55
  
• d1d1zc_ appears in SCOP 1.61
  
• d1d1zc_ appears in SCOP 1.65
  
• d1d1zc_ appears in the current release, SCOPe 2.08