Lineage for d1d1za_ (1d1z A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 260293Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 260294Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 260295Family d.93.1.1: SH2 domain [55551] (22 proteins)
  6. 260472Protein The Xlp protein Sap [55591] (1 species)
  7. 260473Species Human (Homo sapiens) [TaxId:9606] [55592] (5 PDB entries)
  8. 260475Domain d1d1za_: 1d1z A: [40538]

Details for d1d1za_

PDB Entry: 1d1z (more details), 1.4 Å

PDB Description: crystal structure of the xlp protein sap

SCOP Domain Sequences for d1d1za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d1za_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens)}
vavyhgkisretgeklllatgldgsyllrdsesvpgvyclcvlyhgyiytyrvsqtetgs
wsaetapgvhkryfrkiknlisafqkpdqgiviplqypvek

SCOP Domain Coordinates for d1d1za_:

Click to download the PDB-style file with coordinates for d1d1za_.
(The format of our PDB-style files is described here.)

Timeline for d1d1za_: