Lineage for d1d4ta_ (1d4t A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34525Fold d.93: SH2-like [55549] (1 superfamily)
  4. 34526Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 34527Family d.93.1.1: SH2 domain [55551] (19 proteins)
  6. 34661Protein The Xlp protein Sap [55591] (1 species)
  7. 34662Species Human (Homo sapiens) [TaxId:9606] [55592] (3 PDB entries)
  8. 34663Domain d1d4ta_: 1d4t A: [40537]

Details for d1d4ta_

PDB Entry: 1d4t (more details), 1.1 Å

PDB Description: crystal structure of the xlp protein sap in complex with a slam peptide

SCOP Domain Sequences for d1d4ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d4ta_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens)}
mdavavyhgkisretgeklllatgldgsyllrdsesvpgvyclcvlyhgyiytyrvsqte
tgswsaetapgvhkryfrkiknlisafqkpdqgiviplqypvek

SCOP Domain Coordinates for d1d4ta_:

Click to download the PDB-style file with coordinates for d1d4ta_.
(The format of our PDB-style files is described here.)

Timeline for d1d4ta_: