SCOP 1.65: Domain d2shpb3: 2shp B:111-218

Lineage for d2shpb3 (2shp B:111-218)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (1 family)

5. Family d.93.1.1: SH2 domain [55551] (25 proteins)

6. Protein Tyrosine phoshatase shp-2 [55589] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55590] (1 PDB entry)

8. Domain d2shpb3: 2shp B:111-218 [40536]
   Other proteins in same PDB: d2shpa1, d2shpb1
   complexed with cat; mutant

Details for d2shpb3

PDB Entry: 2shp, 2 Å

PDB Description: tyrosine phosphatase shp-2

SCOP Domain Sequences for d2shpb3:

Sequence, based on SEQRES records:

>d2shpb3 d.93.1.1 (B:111-218) Tyrosine phoshatase shp-2 {Human (Homo sapiens)}
rwfhghlsgkeaeklltekgkhgsflvresqshpgdfvlsvrtgddkgesndgkskvthv
mircqelkydvgggerfdsltdlvehykknpmvetlgtvlqlkqplnt

Sequence, based on observed residues (ATOM records):

>d2shpb3 d.93.1.1 (B:111-218) Tyrosine phoshatase shp-2 {Human (Homo sapiens)}
rwfhghlsgkeaeklltekgkhgsflvresqshpgdfvlsvrtgdndgkskvthvmircq
elkydvgggerfdsltdlvehykknpmvetlgtvlqlkqplnt

Timeline for d2shpb3:

• d2shpb3 first appeared (with stable ids) in SCOP 1.55
  
• d2shpb3 appears in SCOP 1.63
  
• d2shpb3 appears in SCOP 1.67
  
• d2shpb3 appears in the current release, SCOPe 2.08