| Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
| Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices |
Superfamily d.93.1: SH2 domain [55550] (1 family) ![]() |
| Family d.93.1.1: SH2 domain [55551] (25 proteins) |
| Protein Tyrosine phoshatase shp-2 [55589] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [55590] (1 PDB entry) |
| Domain d2shpb3: 2shp B:111-218 [40536] Other proteins in same PDB: d2shpa1, d2shpb1 complexed with cat; mutant |
PDB Entry: 2shp (more details), 2 Å
SCOP Domain Sequences for d2shpb3:
Sequence, based on SEQRES records: (download)
>d2shpb3 d.93.1.1 (B:111-218) Tyrosine phoshatase shp-2 {Human (Homo sapiens)}
rwfhghlsgkeaeklltekgkhgsflvresqshpgdfvlsvrtgddkgesndgkskvthv
mircqelkydvgggerfdsltdlvehykknpmvetlgtvlqlkqplnt
>d2shpb3 d.93.1.1 (B:111-218) Tyrosine phoshatase shp-2 {Human (Homo sapiens)}
rwfhghlsgkeaeklltekgkhgsflvresqshpgdfvlsvrtgdndgkskvthvmircq
elkydvgggerfdsltdlvehykknpmvetlgtvlqlkqplnt
Timeline for d2shpb3: