Lineage for d7jr6b2 (7jr6 B:76-199)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2713389Protein Class sigma GST [81351] (5 species)
  7. 2713402Species Human (Homo sapiens) [TaxId:9606] [89061] (16 PDB entries)
    Uniprot O60760; synonym: hematopoietic prostaglandin D synthase
  8. 2713436Domain d7jr6b2: 7jr6 B:76-199 [405337]
    Other proteins in same PDB: d7jr6a1, d7jr6a3, d7jr6b1, d7jr6b3
    automated match to d1pd211
    complexed with gsh, mg, na, vh4

Details for d7jr6b2

PDB Entry: 7jr6 (more details), 1.88 Å

PDB Description: h-pdgs complexed with a 2-phenylimidazo[1,2-a]pyridine-6-carboxamide inhibitors
PDB Compounds: (B:) hematopoietic prostaglandin d synthase

SCOPe Domain Sequences for d7jr6b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7jr6b2 a.45.1.1 (B:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]}
dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl
ggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp
qtkl

SCOPe Domain Coordinates for d7jr6b2:

Click to download the PDB-style file with coordinates for d7jr6b2.
(The format of our PDB-style files is described here.)

Timeline for d7jr6b2: