Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices |
Superfamily d.93.1: SH2 domain [55550] (1 family) |
Family d.93.1.1: SH2 domain [55551] (30 proteins) Pfam 00017 |
Protein Tyrosine phoshatase shp-2 [55589] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [55590] (1 PDB entry) |
Domain d2shpa2: 2shp A:2-110 [40533] Other proteins in same PDB: d2shpa1, d2shpb1 |
PDB Entry: 2shp (more details), 2 Å
SCOP Domain Sequences for d2shpa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2shpa2 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Human (Homo sapiens)} ksrrwfhpnitgveaenllltrgvdgsflarpsksnpgdltlsvrrngavthikiqntgd yydlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptse
Timeline for d2shpa2: