Lineage for d1fbva3 (1fbv A:264-355)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1661863Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 1661864Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1661865Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 1661972Protein Cbl [55587] (1 species)
  7. 1661973Species Human (Homo sapiens) [TaxId:9606] [55588] (10 PDB entries)
  8. 1661988Domain d1fbva3: 1fbv A:264-355 [40532]
    Other proteins in same PDB: d1fbva1, d1fbva2, d1fbva4, d1fbvc_
    complexed with so4, zn

Details for d1fbva3

PDB Entry: 1fbv (more details), 2.9 Å

PDB Description: structure of a cbl-ubch7 complex: ring domain function in ubiquitin- protein ligases
PDB Compounds: (A:) signal transduction protein cbl

SCOPe Domain Sequences for d1fbva3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fbva3 d.93.1.1 (A:264-355) Cbl {Human (Homo sapiens) [TaxId: 9606]}
thpgymafltydevkarlqkfihkpgsyifrlsctrlgqwaigyvtadgnilqtiphnkp
lfqalidgfregfylfpdgrnqnpdltglcep

SCOPe Domain Coordinates for d1fbva3:

Click to download the PDB-style file with coordinates for d1fbva3.
(The format of our PDB-style files is described here.)

Timeline for d1fbva3: