Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices |
Superfamily d.93.1: SH2 domain [55550] (1 family) |
Family d.93.1.1: SH2 domain [55551] (28 proteins) |
Protein Cbl [55587] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [55588] (3 PDB entries) |
Domain d1fbva3: 1fbv A:264-355 [40532] Other proteins in same PDB: d1fbva1, d1fbva2, d1fbva4, d1fbvc_ complexed with so4, zn |
PDB Entry: 1fbv (more details), 2.9 Å
SCOP Domain Sequences for d1fbva3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fbva3 d.93.1.1 (A:264-355) Cbl {Human (Homo sapiens)} thpgymafltydevkarlqkfihkpgsyifrlsctrlgqwaigyvtadgnilqtiphnkp lfqalidgfregfylfpdgrnqnpdltglcep
Timeline for d1fbva3: