SCOP 1.57: Domain d1fbva3: 1fbv A:264-355

Lineage for d1fbva3 (1fbv A:264-355)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)

4. Superfamily d.93.1: SH2 domain [55550] (1 family)

5. Family d.93.1.1: SH2 domain [55551] (20 proteins)

6. Protein Cbl [55587] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55588] (3 PDB entries)

8. Domain d1fbva3: 1fbv A:264-355 [40532]
   Other proteins in same PDB: d1fbva1, d1fbva2, d1fbva4, d1fbvc_

Details for d1fbva3

PDB Entry: 1fbv, 2.9 Å

PDB Description: structure of a cbl-ubch7 complex: ring domain function in ubiquitin- protein ligases

SCOP Domain Sequences for d1fbva3:

Sequence; same for both SEQRES and ATOM records:

>d1fbva3 d.93.1.1 (A:264-355) Cbl {Human (Homo sapiens)}
thpgymafltydevkarlqkfihkpgsyifrlsctrlgqwaigyvtadgnilqtiphnkp
lfqalidgfregfylfpdgrnqnpdltglcep

Timeline for d1fbva3:

• d1fbva3 first appeared (with stable ids) in SCOP 1.55
  
• d1fbva3 appears in SCOP 1.59
  
• d1fbva3 appears in the current release, SCOPe 2.08