Class a: All alpha proteins [46456] (289 folds) |
Fold a.36: Signal peptide-binding domain [47445] (1 superfamily) 4 helices; orthogonal array |
Superfamily a.36.1: Signal peptide-binding domain [47446] (2 families) |
Family a.36.1.0: automated matches [273795] (1 protein) not a true family |
Protein automated matches [273796] (2 species) not a true protein |
Species Aeropyrum pernix [TaxId:272557] [405310] (1 PDB entry) |
Domain d7epka3: 7epk A:294-427 [405311] Other proteins in same PDB: d7epka1, d7epka2 automated match to d1qzxa2 complexed with gdp, mg |
PDB Entry: 7epk (more details), 2.7 Å
SCOPe Domain Sequences for d7epka3:
Sequence; same for both SEQRES and ATOM records: (download)
>d7epka3 a.36.1.0 (A:294-427) automated matches {Aeropyrum pernix [TaxId: 272557]} gdleslleriksleeageldraaedvlkgritmrtiyrqlramrklgplgkvlqmlpgas mlasidegalklgeekmkrwmaiiesmtyeeldrpeiidkrrmrriaigsgtsvddvrel lvyyknlktmmkkl
Timeline for d7epka3: