Lineage for d7epka3 (7epk A:294-427)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323108Fold a.36: Signal peptide-binding domain [47445] (1 superfamily)
    4 helices; orthogonal array
  4. 2323109Superfamily a.36.1: Signal peptide-binding domain [47446] (2 families) (S)
  5. 2323144Family a.36.1.0: automated matches [273795] (1 protein)
    not a true family
  6. 2323145Protein automated matches [273796] (2 species)
    not a true protein
  7. 2323146Species Aeropyrum pernix [TaxId:272557] [405310] (1 PDB entry)
  8. 2323147Domain d7epka3: 7epk A:294-427 [405311]
    Other proteins in same PDB: d7epka1, d7epka2
    automated match to d1qzxa2
    complexed with gdp, mg

Details for d7epka3

PDB Entry: 7epk (more details), 2.7 Å

PDB Description: crystal structure of signal recognition particle 54 kda protein (srp54) from aeropyrum pernix k1 in complex with gdp
PDB Compounds: (A:) Signal recognition particle 54 kDa protein

SCOPe Domain Sequences for d7epka3:

Sequence; same for both SEQRES and ATOM records: (download)

>d7epka3 a.36.1.0 (A:294-427) automated matches {Aeropyrum pernix [TaxId: 272557]}
gdleslleriksleeageldraaedvlkgritmrtiyrqlramrklgplgkvlqmlpgas
mlasidegalklgeekmkrwmaiiesmtyeeldrpeiidkrrmrriaigsgtsvddvrel
lvyyknlktmmkkl

SCOPe Domain Coordinates for d7epka3:

Click to download the PDB-style file with coordinates for d7epka3.
(The format of our PDB-style files is described here.)

Timeline for d7epka3: