SCOP 1.55: Domain d1b47c3: 1b47 C:264-350

Lineage for d1b47c3 (1b47 C:264-350)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)

4. Superfamily d.93.1: SH2 domain [55550] (1 family)

5. Family d.93.1.1: SH2 domain [55551] (19 proteins)

6. Protein Cbl [55587] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55588] (3 PDB entries)

8. Domain d1b47c3: 1b47 C:264-350 [40531]
   Other proteins in same PDB: d1b47a1, d1b47a2, d1b47b1, d1b47b2, d1b47c1, d1b47c2

Details for d1b47c3

PDB Entry: 1b47, 2.2 Å

PDB Description: structure of the n-terminal domain of cbl in complex with its binding site in zap-70

SCOP Domain Sequences for d1b47c3:

Sequence; same for both SEQRES and ATOM records:

>d1b47c3 d.93.1.1 (C:264-350) Cbl {Human (Homo sapiens)}
thpgymafltydevkarlqkfihkpgsyifrlsctrlgqwaigyvtadgnilqtiphnkp
lfqalidgfregfylfpdgrnqnpdlt

Timeline for d1b47c3:

• d1b47c3 appears in SCOP 1.57
  
• d1b47c3 appears in the current release, SCOPe 2.08