Lineage for d7epka2 (7epk A:88-293)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2871589Species Aeropyrum pernix [TaxId:272557] [231666] (4 PDB entries)
  8. 2871594Domain d7epka2: 7epk A:88-293 [405309]
    Other proteins in same PDB: d7epka1, d7epka3
    automated match to d1qzxa3
    complexed with gdp, mg

Details for d7epka2

PDB Entry: 7epk (more details), 2.7 Å

PDB Description: crystal structure of signal recognition particle 54 kda protein (srp54) from aeropyrum pernix k1 in complex with gdp
PDB Compounds: (A:) Signal recognition particle 54 kDa protein

SCOPe Domain Sequences for d7epka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7epka2 c.37.1.0 (A:88-293) automated matches {Aeropyrum pernix [TaxId: 272557]}
pqvdppktpwivllvgvqgsgktttagklayyyvrrgykvglvssdthrpgayeqlkrla
eeagamfygeregdpaeiarrgledllsrgaeivivdtagrhghgeearlldemkaiask
vrpdevalvidasigqkamglaerfhkstpigsiivtkmdgtargggaltaaavtgarik
figtgetlgelepfaprrfvarilgm

SCOPe Domain Coordinates for d7epka2:

Click to download the PDB-style file with coordinates for d7epka2.
(The format of our PDB-style files is described here.)

Timeline for d7epka2: