Class a: All alpha proteins [46456] (289 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (2 families) |
Family a.24.13.0: automated matches [229049] (1 protein) not a true family |
Protein automated matches [229050] (7 species) not a true protein |
Species Aeropyrum pernix [TaxId:272557] [405307] (1 PDB entry) |
Domain d7epka1: 7epk A:2-87 [405308] Other proteins in same PDB: d7epka2, d7epka3 automated match to d1qzxa1 complexed with gdp, mg |
PDB Entry: 7epk (more details), 2.7 Å
SCOPe Domain Sequences for d7epka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7epka1 a.24.13.0 (A:2-87) automated matches {Aeropyrum pernix [TaxId: 272557]} megvrravakflrgggvyekavdafvkdlqrelikadvnvklvlnvtrrikeralkeepp pgvtrrdwmikivyeelvklfggdqe
Timeline for d7epka1: