SCOPe 2.08: Domain d7epka1: 7epk A:2-87

Lineage for d7epka1 (7epk A:2-87)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (2 families)

5. Family a.24.13.0: automated matches [229049] (1 protein)
   not a true family

6. Protein automated matches [229050] (7 species)
   not a true protein

7. Species Aeropyrum pernix [TaxId:272557] [405307] (1 PDB entry)

8. Domain d7epka1: 7epk A:2-87 [405308]
   Other proteins in same PDB: d7epka2, d7epka3
   automated match to d1qzxa1
   complexed with gdp, mg

Details for d7epka1

PDB Entry: 7epk, 2.7 Å

PDB Description: crystal structure of signal recognition particle 54 kda protein (srp54) from aeropyrum pernix k1 in complex with gdp

PDB Compounds: (A:) Signal recognition particle 54 kDa protein

SCOPe Domain Sequences for d7epka1:

Sequence; same for both SEQRES and ATOM records:

>d7epka1 a.24.13.0 (A:2-87) automated matches {Aeropyrum pernix [TaxId: 272557]}
megvrravakflrgggvyekavdafvkdlqrelikadvnvklvlnvtrrikeralkeepp
pgvtrrdwmikivyeelvklfggdqe

Timeline for d7epka1:

• d7epka1 first appeared in SCOPe 2.07