Lineage for d7epka1 (7epk A:2-87)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700314Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (2 families) (S)
  5. 2700370Family a.24.13.0: automated matches [229049] (1 protein)
    not a true family
  6. 2700371Protein automated matches [229050] (7 species)
    not a true protein
  7. 2700372Species Aeropyrum pernix [TaxId:272557] [405307] (1 PDB entry)
  8. 2700373Domain d7epka1: 7epk A:2-87 [405308]
    Other proteins in same PDB: d7epka2, d7epka3
    automated match to d1qzxa1
    complexed with gdp, mg

Details for d7epka1

PDB Entry: 7epk (more details), 2.7 Å

PDB Description: crystal structure of signal recognition particle 54 kda protein (srp54) from aeropyrum pernix k1 in complex with gdp
PDB Compounds: (A:) Signal recognition particle 54 kDa protein

SCOPe Domain Sequences for d7epka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7epka1 a.24.13.0 (A:2-87) automated matches {Aeropyrum pernix [TaxId: 272557]}
megvrravakflrgggvyekavdafvkdlqrelikadvnvklvlnvtrrikeralkeepp
pgvtrrdwmikivyeelvklfggdqe

SCOPe Domain Coordinates for d7epka1:

Click to download the PDB-style file with coordinates for d7epka1.
(The format of our PDB-style files is described here.)

Timeline for d7epka1: