Lineage for d1b47a3 (1b47 A:264-350)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 194873Fold d.93: SH2-like [55549] (1 superfamily)
  4. 194874Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 194875Family d.93.1.1: SH2 domain [55551] (20 proteins)
  6. 194929Protein Cbl [55587] (1 species)
  7. 194930Species Human (Homo sapiens) [TaxId:9606] [55588] (3 PDB entries)
  8. 194932Domain d1b47a3: 1b47 A:264-350 [40529]
    Other proteins in same PDB: d1b47a1, d1b47a2, d1b47b1, d1b47b2, d1b47c1, d1b47c2

Details for d1b47a3

PDB Entry: 1b47 (more details), 2.2 Å

PDB Description: structure of the n-terminal domain of cbl in complex with its binding site in zap-70

SCOP Domain Sequences for d1b47a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b47a3 d.93.1.1 (A:264-350) Cbl {Human (Homo sapiens)}
thpgymafltydevkarlqkfihkpgsyifrlsctrlgqwaigyvtadgnilqtiphnkp
lfqalidgfregfylfpdgrnqnpdlt

SCOP Domain Coordinates for d1b47a3:

Click to download the PDB-style file with coordinates for d1b47a3.
(The format of our PDB-style files is described here.)

Timeline for d1b47a3: