Lineage for d7equb_ (7equ B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2914985Family c.94.1.2: Transferrin [53888] (4 proteins)
    further duplication: composed of two two-domain lobes
  6. 2914986Protein Lactoferrin [53889] (6 species)
  7. 2914992Species Cow (Bos taurus) [TaxId:9913] [53891] (20 PDB entries)
  8. 2915010Domain d7equb_: 7equ B: [405289]
    automated match to d1nkxa_
    complexed with bct, fe, nag

Details for d7equb_

PDB Entry: 7equ (more details), 2.74 Å

PDB Description: crystal structure of the c-lobe of lactoferrin produced by limited proteolysis using pepsin at 2.74a resolution
PDB Compounds: (B:) lactotransferrin

SCOPe Domain Sequences for d7equb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7equb_ c.94.1.2 (B:) Lactoferrin {Cow (Bos taurus) [TaxId: 9913]}
ytrvvwcavgpeeqkkcqqwsqqsgqnvtcatasttddcivlvlkgeadalnldggyiyt
agkcglvpvlaenrksskhssldcvlrptegylavavvkkanegltwnslkdkkschtav
drtagwnipmglivnqtgscafdeffsqscapgadpksrlcalcagddqgldkcvpnske
kyygytgafrclaedvgdvafvkndtvwentngestadwaknlkredfrllcldgtrkpv
teaqschlavapnhavvsrsdraahveqvllhqqalfgkngkncpdkfclfksetknllf
ndnteclaklggrptyeeylgteyvtaianlkkcstsplleacafltr

SCOPe Domain Coordinates for d7equb_:

Click to download the PDB-style file with coordinates for d7equb_.
(The format of our PDB-style files is described here.)

Timeline for d7equb_: