Lineage for d7egkd_ (7egk D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2950563Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2950865Family d.58.5.0: automated matches [191474] (1 protein)
    not a true family
  6. 2950866Protein automated matches [190753] (21 species)
    not a true protein
  7. 2951041Species Synechocystis sp. [TaxId:1111708] [352162] (4 PDB entries)
  8. 2951047Domain d7egkd_: 7egk D: [405288]
    automated match to d3dfeb_
    complexed with amp, na

Details for d7egkd_

PDB Entry: 7egk (more details), 2.7 Å

PDB Description: bicarbonate transporter complex sbta-sbtb bound to amp
PDB Compounds: (D:) Membrane-associated protein SbtB

SCOPe Domain Sequences for d7egkd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7egkd_ d.58.5.0 (D:) automated matches {Synechocystis sp. [TaxId: 1111708]}
akpanklvivtekillkkiakiidesgakgytvmntggkgsrnvrssgqpntsdieanik
feiltetremaeeiadrvavkyfndyagiiyicsaevlyghtfcgpegc

SCOPe Domain Coordinates for d7egkd_:

Click to download the PDB-style file with coordinates for d7egkd_.
(The format of our PDB-style files is described here.)

Timeline for d7egkd_: