Lineage for d2cbla3 (2cbl A:264-351)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 260293Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 260294Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 260295Family d.93.1.1: SH2 domain [55551] (22 proteins)
  6. 260349Protein Cbl [55587] (1 species)
  7. 260350Species Human (Homo sapiens) [TaxId:9606] [55588] (3 PDB entries)
  8. 260351Domain d2cbla3: 2cbl A:264-351 [40528]
    Other proteins in same PDB: d2cbla1, d2cbla2
    complexed with ca

Details for d2cbla3

PDB Entry: 2cbl (more details), 2.1 Å

PDB Description: n-terminal domain of cbl in complex with its binding site on zap-70

SCOP Domain Sequences for d2cbla3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cbla3 d.93.1.1 (A:264-351) Cbl {Human (Homo sapiens)}
thpgymafltydevkarlqkfihkpgsyifrlsctrlgqwaigyvtadgnilqtiphnkp
lfqalidgfregfylfpdgrnqnpdltg

SCOP Domain Coordinates for d2cbla3:

Click to download the PDB-style file with coordinates for d2cbla3.
(The format of our PDB-style files is described here.)

Timeline for d2cbla3: