Lineage for d7dz7d_ (7dz7 D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2611448Fold d.187: Photosystem I subunit PsaD [64233] (1 superfamily)
    beta-BETA(2)-beta-alpha-beta(2); antiparallel sheet: order 2134 packed against helix and BETA-hairpin on the same side; irregular C-terminal tail
  4. 2611449Superfamily d.187.1: Photosystem I subunit PsaD [64234] (1 family) (S)
    automatically mapped to Pfam PF02531
  5. 2611450Family d.187.1.1: Photosystem I subunit PsaD [64235] (2 proteins)
  6. 2611461Protein automated matches [236562] (8 species)
    not a true protein
  7. 2611464Species Chlamydomonas reinhardtii [TaxId:3055] [370481] (4 PDB entries)
  8. 2611465Domain d7dz7d_: 7dz7 D: [405279]
    Other proteins in same PDB: d7dz71_, d7dz73_, d7dz74_, d7dz77_, d7dz78_, d7dz79_, d7dz7a_, d7dz7b_, d7dz7c_, d7dz7e_, d7dz7f_, d7dz7j_, d7dz7u_, d7dz7v_, d7dz7w_, d7dz7x_, d7dz7y_, d7dz7z_
    automated match to d5l8rd_
    complexed with bcr, chl, cla, dgd, lhg, lmg, lmu, lut, nex, pqn, sf4, tpo, xat; mutant

Details for d7dz7d_

PDB Entry: 7dz7 (more details), 2.84 Å

PDB Description: state transition supercomplex psi-lhci-lhcii from double phosphatase mutant pph1;pbcp of green alga chlamydomonas reinhardtii
PDB Compounds: (D:) photosystem I reaction center subunit II, chloroplastic

SCOPe Domain Sequences for d7dz7d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7dz7d_ d.187.1.1 (D:) automated matches {Chlamydomonas reinhardtii [TaxId: 3055]}
wtvptlnpdtpspifggstggllrkaqteefyvitweakkeqifemptggaaimrqgpnl
lkfgkkeqclalttqlrnkfkltpcfyrvfpdgkvqylhpadgvypekvnagrvganqnm
rrigqnvnpikvkfsgrmmspae

SCOPe Domain Coordinates for d7dz7d_:

Click to download the PDB-style file with coordinates for d7dz7d_.
(The format of our PDB-style files is described here.)

Timeline for d7dz7d_: