![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily) membrane all-alpha fold; three transmembrane helices |
![]() | Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families) ![]() duplication: contains two structural repeats |
![]() | Family f.43.1.0: automated matches [276197] (1 protein) not a true family |
![]() | Protein automated matches [276200] (4 species) not a true protein |
![]() | Species Chlamydomonas reinhardtii [TaxId:3055] [370435] (5 PDB entries) |
![]() | Domain d7dz71_: 7dz7 1: [405278] Other proteins in same PDB: d7dz7a_, d7dz7b_, d7dz7c_, d7dz7d_, d7dz7e_, d7dz7f_, d7dz7j_, d7dz7u_, d7dz7w_, d7dz7x_, d7dz7y_, d7dz7z_ automated match to d4y281_ complexed with bcr, chl, cla, dgd, lhg, lmg, lmu, lut, nex, pqn, sf4, tpo, xat; mutant |
PDB Entry: 7dz7 (more details), 2.84 Å
SCOPe Domain Sequences for d7dz71_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7dz71_ f.43.1.0 (1:) automated matches {Chlamydomonas reinhardtii [TaxId: 3055]} kagnwlpgsdapawlpddlpgnygfdplslgkepaslkrftesevihgrwamlgvagsla vellgygnwydaplwavnggkatwfgievpfdlnallafefvamaaaegqrgdaggvvyp ggafdplgfakdssksgelklkeikngrlamvaflgfvaqhaatgkgpiaalgehlanpw ganfatngisvpff
Timeline for d7dz71_: