Lineage for d7dz74_ (7dz7 4:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2633630Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily)
    membrane all-alpha fold; three transmembrane helices
  4. 2633631Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families) (S)
    duplication: contains two structural repeats
  5. 2633682Family f.43.1.0: automated matches [276197] (1 protein)
    not a true family
  6. 2633683Protein automated matches [276200] (4 species)
    not a true protein
  7. 2633684Species Chlamydomonas reinhardtii [TaxId:3055] [370435] (5 PDB entries)
  8. 2633687Domain d7dz74_: 7dz7 4: [405274]
    Other proteins in same PDB: d7dz7a_, d7dz7b_, d7dz7c_, d7dz7d_, d7dz7e_, d7dz7f_, d7dz7j_, d7dz7u_, d7dz7w_, d7dz7x_, d7dz7y_, d7dz7z_
    automated match to d5xnls_
    complexed with bcr, chl, cla, dgd, lhg, lmg, lmu, lut, nex, pqn, sf4, tpo, xat; mutant

Details for d7dz74_

PDB Entry: 7dz7 (more details), 2.84 Å

PDB Description: state transition supercomplex psi-lhci-lhcii from double phosphatase mutant pph1;pbcp of green alga chlamydomonas reinhardtii
PDB Compounds: (4:) Chlorophyll a-b binding protein, chloroplastic

SCOPe Domain Sequences for d7dz74_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7dz74_ f.43.1.0 (4:) automated matches {Chlamydomonas reinhardtii [TaxId: 3055]}
daalpswmpgadlpgylngtlpgdfgfdplylgqdpvklkwyaqaelmnarfamlavagi
lvpellsnigfswpgagvawydagkfeyfapasslfgvqmllfawveirryqdfvkpgsa
nqdpiftnnklpdgnepgypggifdpfgwskgdikslklkeikngrlamlafagfigqay
ttgttplknlsthladpwsttvwqndlarl

SCOPe Domain Coordinates for d7dz74_:

Click to download the PDB-style file with coordinates for d7dz74_.
(The format of our PDB-style files is described here.)

Timeline for d7dz74_: