SCOPe 2.08: Domain d7eg3e1: 7eg3 E:2-189

Lineage for d7eg3e1 (7eg3 E:2-189)

Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds)
Fold a.39: EF Hand-like [47472] (4 superfamilies)
core: 4 helices; array of 2 hairpins, opened
Superfamily a.39.1: EF-hand [47473] (12 families)
Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
Duplication: made with two pairs of EF-hands
Protein automated matches [190064] (21 species)
not a true protein
Species Jellyfish (Aequorea victoria) [TaxId:6100] [186782] (7 PDB entries)

Domain d7eg3e1: 7eg3 E:2-189 [405270]
Other proteins in same PDB: d7eg3a2, d7eg3b2, d7eg3c2, d7eg3d2, d7eg3e2, d7eg3f2, d7eg3g2, d7eg3h2, d7eg3i2, d7eg3j2, d7eg3m2, d7eg3n2, d7eg3o2, d7eg3p2
automated match to d4nqga_
complexed with j2u

Details for d7eg3e1

PDB Entry: 7eg3 (more details), 2.09 Å

PDB Description: crystal structure of the apoaequorin complex with (s)-hm-dactz

PDB Compounds: (E:) Aequorin-2

SCOPe Domain Sequences for d7eg3e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7eg3e1 a.39.1.5 (E:2-189) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]}
kltsdfdnprwigrhkhmfnfldvnhngkisldemvykasdivinnlgatpeqakrhkda
veaffggagmkygvetdwpayiegwkklatdelekyakneptliriwgdalfdivdkdqn
gaitldewkaytkaagiiqssedceetfrvcdidesgqldvdemtrqhlgfwytmdpace
klyggavp

SCOPe Domain Coordinates for d7eg3e1:

Click to download the PDB-style file with coordinates for d7eg3e1.
(The format of our PDB-style files is described here.)

Timeline for d7eg3e1: