Lineage for d1bg1a3 (1bg1 A:576-716)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34525Fold d.93: SH2-like [55549] (1 superfamily)
  4. 34526Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 34527Family d.93.1.1: SH2 domain [55551] (19 proteins)
  6. 34642Protein STAT3b [55585] (1 species)
  7. 34643Species Mouse (Mus musculus) [TaxId:10090] [55586] (1 PDB entry)
  8. 34644Domain d1bg1a3: 1bg1 A:576-716 [40527]
    Other proteins in same PDB: d1bg1a1, d1bg1a2

Details for d1bg1a3

PDB Entry: 1bg1 (more details), 2.25 Å

PDB Description: transcription factor stat3b/dna complex

SCOP Domain Sequences for d1bg1a3:

Sequence, based on SEQRES records: (download)

>d1bg1a3 d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus)}
ilalwnegyimgfiskererailstkppgtfllrfsesskeggvtftwvekdisgstqiq
svepytkqqlnnmsfaeiimgykimdatnilvsplvylypdipkeeafgkycrpesqehp
eadpgsaapylktkficvtpf

Sequence, based on observed residues (ATOM records): (download)

>d1bg1a3 d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus)}
ilalwnegyimgfiskererailstkppgtfllrfsesskeggvtftwvekdisgstqiq
svepytkqqlnnmsfaeiimgykimdatnilvsplvylypdipkeeafgkycraapylkt
kficvtpf

SCOP Domain Coordinates for d1bg1a3:

Click to download the PDB-style file with coordinates for d1bg1a3.
(The format of our PDB-style files is described here.)

Timeline for d1bg1a3: