Lineage for d1bg1a3 (1bg1 A:576-716)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2530460Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2530461Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2530462Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2530817Protein STAT3b [55585] (1 species)
  7. 2530818Species Mouse (Mus musculus) [TaxId:10090] [55586] (1 PDB entry)
  8. 2530819Domain d1bg1a3: 1bg1 A:576-716 [40527]
    Other proteins in same PDB: d1bg1a1, d1bg1a2
    protein/DNA complex

Details for d1bg1a3

PDB Entry: 1bg1 (more details), 2.25 Å

PDB Description: transcription factor stat3b/dna complex
PDB Compounds: (A:) protein (transcription factor stat3b)

SCOPe Domain Sequences for d1bg1a3:

Sequence, based on SEQRES records: (download)

>d1bg1a3 d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) [TaxId: 10090]}
ilalwnegyimgfiskererailstkppgtfllrfsesskeggvtftwvekdisgstqiq
svepytkqqlnnmsfaeiimgykimdatnilvsplvylypdipkeeafgkycrpesqehp
eadpgsaapylktkficvtpf

Sequence, based on observed residues (ATOM records): (download)

>d1bg1a3 d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) [TaxId: 10090]}
ilalwnegyimgfiskererailstkppgtfllrfsesskeggvtftwvekdisgstqiq
svepytkqqlnnmsfaeiimgykimdatnilvsplvylypdipkeeafgkycraapylkt
kficvtpf

SCOPe Domain Coordinates for d1bg1a3:

Click to download the PDB-style file with coordinates for d1bg1a3.
(The format of our PDB-style files is described here.)

Timeline for d1bg1a3: