SCOPe 2.08: Domain d1bf5a3: 1bf5 A:569-710

Lineage for d1bf5a3 (1bf5 A:569-710)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein STAT-1 [55583] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55584] (1 PDB entry)

8. Domain d1bf5a3: 1bf5 A:569-710 [40526]
   Other proteins in same PDB: d1bf5a1, d1bf5a2
   protein/DNA complex

Details for d1bf5a3

PDB Entry: 1bf5, 2.9 Å

PDB Description: tyrosine phosphorylated stat-1/dna complex

PDB Compounds: (A:) signal transducer and activator of transcription 1-alpha/beta

SCOPe Domain Sequences for d1bf5a3:

Sequence, based on SEQRES records:

>d1bf5a3 d.93.1.1 (A:569-710) STAT-1 {Human (Homo sapiens) [TaxId: 9606]}
llplwndgcimgfiskererallkdqqpgtfllrfsessregaitftwversqnggepdf
havepytkkelsavtfpdiirnykvmaaenipenplkylypnidkdhafgkyysrpkeap
epmeldgpkgtgyiktelisvs

Sequence, based on observed residues (ATOM records):

>d1bf5a3 d.93.1.1 (A:569-710) STAT-1 {Human (Homo sapiens) [TaxId: 9606]}
llplwndgcimgfiskererallkdqqpgtfllrfsessregaitftwversqnggepdf
havepytkkelsavtfpdiirnykvmaaenipenplkylypnidkdhafgkyysrgyikt
elisvs

Timeline for d1bf5a3:

• d1bf5a3 first appeared (with stable ids) in SCOP 1.55
  
• d1bf5a3 appears in SCOPe 2.07