![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
![]() | Superfamily d.93.1: SH2 domain [55550] (2 families) ![]() |
![]() | Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
![]() | Protein STAT-1 [55583] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [55584] (1 PDB entry) |
![]() | Domain d1bf5a3: 1bf5 A:569-710 [40526] Other proteins in same PDB: d1bf5a1, d1bf5a2 protein/DNA complex |
PDB Entry: 1bf5 (more details), 2.9 Å
SCOPe Domain Sequences for d1bf5a3:
Sequence, based on SEQRES records: (download)
>d1bf5a3 d.93.1.1 (A:569-710) STAT-1 {Human (Homo sapiens) [TaxId: 9606]} llplwndgcimgfiskererallkdqqpgtfllrfsessregaitftwversqnggepdf havepytkkelsavtfpdiirnykvmaaenipenplkylypnidkdhafgkyysrpkeap epmeldgpkgtgyiktelisvs
>d1bf5a3 d.93.1.1 (A:569-710) STAT-1 {Human (Homo sapiens) [TaxId: 9606]} llplwndgcimgfiskererallkdqqpgtfllrfsessregaitftwversqnggepdf havepytkkelsavtfpdiirnykvmaaenipenplkylypnidkdhafgkyysrgyikt elisvs
Timeline for d1bf5a3: