Lineage for d2abl_2 (2abl 140-237)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 260293Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 260294Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 260295Family d.93.1.1: SH2 domain [55551] (22 proteins)
  6. 260296Protein Abl tyrosine kinase [55581] (1 species)
  7. 260297Species Human (Homo sapiens) [TaxId:9606] [55582] (1 PDB entry)
  8. 260298Domain d2abl_2: 2abl 140-237 [40525]
    Other proteins in same PDB: d2abl_1
    mutant

Details for d2abl_2

PDB Entry: 2abl (more details), 2.5 Å

PDB Description: sh3-sh2 domain fragment of human bcr-abl tyrosine kinase

SCOP Domain Sequences for d2abl_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2abl_2 d.93.1.1 (140-237) Abl tyrosine kinase {Human (Homo sapiens)}
slekhswyhgpvsrnaaeyllssgingsflvresesspgqrsislryegrvyhyrintas
dgklyvssesrfntlaelvhhhstvadglittlhypap

SCOP Domain Coordinates for d2abl_2:

Click to download the PDB-style file with coordinates for d2abl_2.
(The format of our PDB-style files is described here.)

Timeline for d2abl_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2abl_1