![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.93: SH2-like [55549] (1 superfamily) |
![]() | Superfamily d.93.1: SH2 domain [55550] (1 family) ![]() |
![]() | Family d.93.1.1: SH2 domain [55551] (19 proteins) |
![]() | Protein Abl tyrosine kinase [55581] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [55582] (1 PDB entry) |
![]() | Domain d2abl_2: 2abl 140-237 [40525] Other proteins in same PDB: d2abl_1 |
PDB Entry: 2abl (more details), 2.5 Å
SCOP Domain Sequences for d2abl_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2abl_2 d.93.1.1 (140-237) Abl tyrosine kinase {Human (Homo sapiens)} slekhswyhgpvsrnaaeyllssgingsflvresesspgqrsislryegrvyhyrintas dgklyvssesrfntlaelvhhhstvadglittlhypap
Timeline for d2abl_2: