Lineage for d1blja_ (1blj A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965229Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2965523Protein P55 Blk protein tyrosine kinase [55579] (1 species)
  7. 2965524Species Mouse (Mus musculus) [TaxId:10090] [55580] (2 PDB entries)
  8. 2965526Domain d1blja_: 1blj A: [40524]

Details for d1blja_

PDB Entry: 1blj (more details)

PDB Description: nmr ensemble of blk sh2 domain, 20 structures
PDB Compounds: (A:) p55 blk protein tyrosine kinase

SCOPe Domain Sequences for d1blja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1blja_ d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]}
gsvapvetlevekwffrtisrkdaerqllapmnkagsfliresesnkgafslsvkdittq
gevvkhykirsldnggyyispritfptlqalvqhyskkgdglcqkltlpcvnla

SCOPe Domain Coordinates for d1blja_:

Click to download the PDB-style file with coordinates for d1blja_.
(The format of our PDB-style files is described here.)

Timeline for d1blja_: