| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
| Family c.94.1.2: Transferrin [53888] (4 proteins) further duplication: composed of two two-domain lobes |
| Protein Lactoferrin [53889] (6 species) |
| Species Cow (Bos taurus) [TaxId:9913] [53891] (20 PDB entries) |
| Domain d7equa_: 7equ A: [405239] automated match to d1nkxa_ complexed with bct, fe, nag |
PDB Entry: 7equ (more details), 2.74 Å
SCOPe Domain Sequences for d7equa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7equa_ c.94.1.2 (A:) Lactoferrin {Cow (Bos taurus) [TaxId: 9913]}
ytrvvwcavgpeeqkkcqqwsqqsgqnvtcatasttddcivlvlkgeadalnldggyiyt
agkcglvpvlaenrksskhssldcvlrptegylavavvkkanegltwnslkdkkschtav
drtagwnipmglivnqtgscafdeffsqscapgadpksrlcalcagddqgldkcvpnske
kyygytgafrclaedvgdvafvkndtvwentngestadwaknlkredfrllcldgtrkpv
teaqschlavapnhavvsrsdraahveqvllhqqalfgkngkncpdkfclfksetknllf
ndnteclaklggrptyeeylgteyvtaianlkkcstsplleacafltr
Timeline for d7equa_: