![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
![]() | Superfamily f.23.18: Subunit IX of photosystem I reaction centre, PsaJ [81544] (2 families) ![]() automatically mapped to Pfam PF01701 |
![]() | Family f.23.18.0: automated matches [276196] (1 protein) not a true family |
![]() | Protein automated matches [276198] (4 species) not a true protein |
![]() | Species Chlamydomonas reinhardtii [TaxId:3055] [370433] (4 PDB entries) |
![]() | Domain d7dz7j_: 7dz7 J: [405225] Other proteins in same PDB: d7dz71_, d7dz73_, d7dz74_, d7dz77_, d7dz78_, d7dz79_, d7dz7a_, d7dz7b_, d7dz7c_, d7dz7d_, d7dz7e_, d7dz7f_, d7dz7u_, d7dz7v_, d7dz7w_, d7dz7x_, d7dz7y_, d7dz7z_ automated match to d5l8rj_ complexed with bcr, chl, cla, dgd, lhg, lmg, lmu, lut, nex, pqn, sf4, tpo, xat; mutant |
PDB Entry: 7dz7 (more details), 2.84 Å
SCOPe Domain Sequences for d7dz7j_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7dz7j_ f.23.18.0 (J:) automated matches {Chlamydomonas reinhardtii [TaxId: 3055]} mkdfttylstapviatiwftftagllieinryfpdplvfsf
Timeline for d7dz7j_: