Lineage for d7dz7j_ (7dz7 J:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631539Superfamily f.23.18: Subunit IX of photosystem I reaction centre, PsaJ [81544] (2 families) (S)
    automatically mapped to Pfam PF01701
  5. 2631562Family f.23.18.0: automated matches [276196] (1 protein)
    not a true family
  6. 2631563Protein automated matches [276198] (4 species)
    not a true protein
  7. 2631566Species Chlamydomonas reinhardtii [TaxId:3055] [370433] (4 PDB entries)
  8. 2631567Domain d7dz7j_: 7dz7 J: [405225]
    Other proteins in same PDB: d7dz71_, d7dz73_, d7dz74_, d7dz77_, d7dz78_, d7dz79_, d7dz7a_, d7dz7b_, d7dz7c_, d7dz7d_, d7dz7e_, d7dz7f_, d7dz7u_, d7dz7v_, d7dz7w_, d7dz7x_, d7dz7y_, d7dz7z_
    automated match to d5l8rj_
    complexed with bcr, chl, cla, dgd, lhg, lmg, lmu, lut, nex, pqn, sf4, tpo, xat; mutant

Details for d7dz7j_

PDB Entry: 7dz7 (more details), 2.84 Å

PDB Description: state transition supercomplex psi-lhci-lhcii from double phosphatase mutant pph1;pbcp of green alga chlamydomonas reinhardtii
PDB Compounds: (J:) Photosystem I reaction center subunit IX

SCOPe Domain Sequences for d7dz7j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7dz7j_ f.23.18.0 (J:) automated matches {Chlamydomonas reinhardtii [TaxId: 3055]}
mkdfttylstapviatiwftftagllieinryfpdplvfsf

SCOPe Domain Coordinates for d7dz7j_:

Click to download the PDB-style file with coordinates for d7dz7j_.
(The format of our PDB-style files is described here.)

Timeline for d7dz7j_: