Lineage for d7e8ib_ (7e8i B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698446Protein Histone H4 [47125] (7 species)
  7. 2698447Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (45 PDB entries)
  8. 2698514Domain d7e8ib_: 7e8i B: [405220]
    Other proteins in same PDB: d7e8ia_, d7e8ic_, d7e8id_, d7e8ie_, d7e8ig_, d7e8ih_, d7e8il_
    automated match to d1kx5b_
    protein/DNA complex

Details for d7e8ib_

PDB Entry: 7e8i (more details), 3.1 Å

PDB Description: structural insight into brca1-bard1 complex recruitment to damaged chromatin
PDB Compounds: (B:) histone h4

SCOPe Domain Sequences for d7e8ib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7e8ib_ a.22.1.1 (B:) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
ggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavty
tehakrktvtamdvvyalkrqgrtlygfg

SCOPe Domain Coordinates for d7e8ib_:

Click to download the PDB-style file with coordinates for d7e8ib_.
(The format of our PDB-style files is described here.)

Timeline for d7e8ib_: